PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_43368
Common NameKK1_044611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 333aa    MW: 36480.7 Da    PI: 6.7578
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_43368genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEde+l++++ ++G g +W + +++ g++R++k+c++rw++yl
    C.cajan_43368 14 KGPWSPEEDEKLKEYIDKHGIGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     79******************999************************97 PP

2Myb_DNA-binding38.72.3e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++++Ed ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
    C.cajan_43368  69 GEFSEDEDRIICSLFASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3962IPR017930Myb domain
SuperFamilySSF466891.1E-2711109IPR009057Homeodomain-like
SMARTSM007175.9E-121364IPR001005SANT/Myb domain
PfamPF002496.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-241569IPR009057Homeodomain-like
CDDcd001671.63E-91662No hitNo description
PROSITE profilePS5129421.75763117IPR017930Myb domain
SMARTSM007173.9E-1267115IPR001005SANT/Myb domain
PfamPF002492.9E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-2370117IPR009057Homeodomain-like
CDDcd001671.69E-870113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDEKLKEYID KHGIGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNLKHGE FSEDEDRIIC SLFASIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKMMGI  120
MNPSALKKPH EVTMLQSSTP SSSNSSSSTL SFKTNHNNSC YQPQVSFTES ISYSSLLSGN  180
SSTTCAYSST FQAQESSFGF GPIQNCQVSS GFVLGGETSC SSSSDGSYNN NNNQMSHVKE  240
AELGYGGDGS FGEHVIIGGL GYLSSGVEDL ATQKLMMPSN AGRVSGWTGE ESRLWGESAL  300
DYGLEEIKQL ISTSSCNNFM FDDSKTGEMV MYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312651e-159KT031265.1 Glycine max clone HN_CCL_53 MYB/HD-like transcription factor (Glyma13g20510.1_like1) mRNA, partial cds.
GenBankKT0312661e-159KT031266.1 Glycine max clone HN_CCL_52 MYB/HD-like transcription factor (Glyma13g20510.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535147.11e-160PREDICTED: transcription factor RAX2-like
TrEMBLA0A151QVU20.0A0A151QVU2_CAJCA; Transcription factor RAX2
STRINGGLYMA10G06190.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-76myb domain protein 36